Síntese de Peptídeos

Home / Síntese de Peptídeos

A GenOne fornece uma gama completa de serviços de produção de peptídeos de altíssima qualidade que vão desde a síntese de peptídeos, síntese seguindo boas práticas de fabricação (BPF), modificações, biblioteca de peptídeos e arrays. Além disso, realizamos gratuitamente o design de peptídeos imunogênicos visando a produção de anticorpos.Oferecemos peptídeos sintéticos produzidos sob processos com Garantia Total da Qualidade e ISO 9001:2008 para garantir a satisfação completa dos nossos clientes. As análises MS e HPLC são realizadas em todos os peptídeos produzidos. O controle da qualidade e a garantia da qualidade seguem procedimentos de forma independente visando oferecer dupla garantia e a mais alta qualidade possível em cada peptídeo entregue.

Os peptídeos sintéticos oferecem vantagens para diversas aplicações, indo desde novas drogas até a pesquisa do funcionamento e interação de proteínas.

Peptideos-Sinteticos

Recomendação de Pureza

A GenOne Biotechnologies propõe a seguir uma tabela com a pureza dos peptídeos recomendada para os ensaios mais comuns solicitados pelos nossos clientes.

Pureza recomendada
Aplicações
Imunologia
Pureza > 70%
  • Antígeno para a produção e purificação por afinidade de anticorpos policlonais
  • Testes de ELISA
  • Peptide arrays
Bioquímica
Pureza > 85%
  • Mapeamento de epítopos
  • Estudos semi-quantitativos de interação enzima-substrato
  • Estudos de fosforilação
  • Estudos de peptide blocking por Western blotting
  • Ensaios in vitro
  • Estudos de aderência celular
Alta Pureza
Pureza > 95%
  • Estudos quantitativos de interação receptor-ligante
  • Ensaios quantitativos de inibição e bloqueio competitivos
  • Estudos quantitativos de fosforilação
  • Estudos quantitativosde proteólise
  • Estudos de NMR
  • Ensaios in vitro
  • Estudos in vivo
  • Geração de curvas de padrão
Industrial
Pureza > 98%
  • Peptídeos BPF para estudos de drogas
  • Peptídeos para a indústria cosmética
  • Ensaios clínicos
  • Estudos de relação estrutura x atividade (SAR)

Observações

Pureza:

Quando um peptídeo é entregue com pureza de 95%, isso significa que 95% do conteúdo de peptídeo entregue é composto pelo peptídeo solicitado (o que difere do conteúdo total do peptídeo). Os outros 5% de material peptídico é usualmente composto do que é chamado de "sequências deletadas" que usualmente podem ser co-purificadas com o peptídeo desejado durante a HPLC. As sequências deletadas são geradas durante a síntese dos peptídeos, quando devido a ineficiência da reação de acoplamento, alguns aminoácidos são omitidos das moléculas sintetizadas. A pureza é determinada por HPLC de fase reversa.

Conteúdo peptídico x Conteúdo total:

É importante entender a diferença entre conteúdo peptídico e conteúdo total de peptídeos. Os peptídeos secos e entregues na forma de pó, normalmente não possuem somente peptídeos, mas também algumas substâncias como água, solventes adsorvidos, contra-íons e sais. Devido a própria natureza dos peptídeos, dificuldade de solubilidade, haverá quase sempre outros aditivos de forma a permitir solubilidade e estabilidade. O conteúdo total se refere a esta mistura enquanto o conteúdo peptídico refere-se à fração do seu peptídeo na mistura. O conteúdo peptídico é usualmente 50-80% da massa total de pó enviado, esse conteúdo só é obtido precisamente pela análise do conteúdo de aminoácidos ou quantidade de nitrogênio que pode ser solicitada como um serviço à parte, bem como a remoção de TFA.

Como estimar o conteúdo peptídico teórico?

Existe uma maneira de se estimar o conteúdo peptídico teórico, assumindo que o único conteúdo não peptídico presente na amostra são os contra-íons. É possível fazer isso dividindo a massa molecular do peptídeo pela soma da massa molecular com o número de contra-íons necessários para neutralizar o peptídeo. O número de contra-íons é multiplicado pela massa molecular do TFA (MW=114).

Por exemplo, um peptídeo com massa molecular de 1500, com N-Terminal livre e uma Arginina, o seu conteúdo líquido é = 1500/(1500+2x114)= 0,87 ou 87%.
Na prática, os contra-íons não são os únicos contaminantes, como citado anteriormente há também algumas substâncias como água, solventes adsorvidos e sais.

Modificações Realizadas

A seguir mostramos a grande diversidade de modificações que podem ser realizadas ao fazer o seu pedido com a GenOne Biotechnologies, porém caso deseje alguma que não esteja na lista não hesite em solicitar mais informações.

Modificações N-Terminal Modificações C-Terminal Modificações diversas
Acetilatação (Ac) Amidação Biotinilação, Fluoróforos
Formilação (For) AMC Pontes dissulfeto
Ácidos Graxos Aldeído Fosforilação
Benzoil (Bz) Alcool Conjugação com BSA, KLH, OVA
Benziloxicarbonilação (CBZ) Éster (OMe, OEt) PEGlação
Bromoacetil (Br-Ac) p-Nitroanilina (pNA) MAPS
Piroglutamil (pGlu) (Pyr) NHMe, NHEt e NHisopen Peptídeos Cíclicos
Succinilação (Suc) tBu Fluorescência e Quenchers
tert-Butoxicarbonil (Boc) TBzl Aminoácidos Especiais
3-Mercaptopropil (Mpa) Cisteamida (Cya) Metil e N-Metil

Cell Penetrating Peptides

Os CPPs são capazes de transportar ácidos nucleicos e nanomateriais para o interior das células.

Veja Aqui: CPPs

Peptídeos Catalogados

Peptídeos catalogados, pedido mínimo de 2mg .

N° de Catálogo Nome | Sequência
GO12400 DLAT Peptide | GDLLAEIETDKATI
GO12401 MAGEA3 Peptide | EGPSTFPDLESEFQAALSRKVAELVHFLLLKY
GO12402 Adgrd1 Peptide | TNFAILMQVVPLKLTH
GO12403 DES Peptide | TSGGAGGLGALR
GO12404 CASQ1 Peptide | ELQAFENIEDEIK
GO12405 E7ER51 Peptide | GEFQLVLDALDK
GO12406 E7ER51 Peptide | GGPLTAAYR
GO12407 MB Peptide | YLEFISDAIIHVLHAK
GO12408 VIM Peptide | TLYTSSPGGVYATR
GO12409 Apovitellenin-1 Peptide | DWLVIPDAAAAYIYEAVNK
GO12410 TAGLN Peptide | TLVALGSLAVTK
GO12411 fbpB Peptide | FQDAYNGAGGHNAVF
GO12412 RHO Peptide | CSKTETSQVAPA
GO12413 BOTBODRAFT_145813 Peptide | MGLHDYEL
GO12414 VP1 Peptide | FGEHLQANDLDYGQC
GO12415 cap Peptide | TGDTESVPDPQPIGE
GO12416 cap Peptide | VGSSSGNWHCDSQWL
GO12417 cap Peptide | GNWHCDSQWLGDRVI
GO12418 cap Peptide | DNAYFGYSTPWGYFD
GO12419 VP1 Peptide | SFYCLEYFPSQMLRT
GO12420 VP1 Peptide | YCLEYFPSQMLRTGN
GO12421 VP1 Peptide | SLDRLMNPLIDQYLY
GO12422 cap Peptide | ASSWALNGRNSLMNP
GO12423 VP1 Peptide | GTVNSQGALPGMVWQ
GO12424 cap Peptide | VEFAVNTEGVYSEPR
GO12425 CFTR Peptide | RTLKQAFAD
GO12426 CFTR Peptide | EDSDEPLERRLSLVP
GO12427 RGD Peptide | c(RGDyC)
GO12428 csn1s2 Peptide | QGPIVLNPWDQVK
GO12429 KLVFF Peptide | KLVFF
GO12430 CD3E Peptide | Ac-QDGNEEMGGK(Biotin)-CONH2
GO12431 Kcnma1 Peptide | GGPESFYCASW
GO12432 CREM Peptide | CKRREILSRRPSYRK
GO12433 B4100_2996 Peptide | GGGGSGGGGSK(Biotin)-COOH
GO12434 Protein E6 Peptide | EDPTRRPYKLPDLCTELNTSLQDIEITCVY
GO12435 SNPF Peptide | AQRSPSLRLRF-CONH2
GO12436 SIFa Peptide | AYRKPPFNGSIF-CONH2
GO12437 TNFRSF1A Peptide | LRHCLSCSKCRKEM
GO12438 ELH1 Peptide | APRLRFYSL
GO12439 OsCLE402 Peptide | REVPTGPDPIHH
GO12440 D623_10003841 Peptide | KTCPVQQWV
GO12441 ccmA Peptide | RLLLAPRPL
GO12442 SNCA Peptide | GILEDMPVDPDNEAYEMPSEEG
GO12443 ccmN Peptide | VYGKEQFLRMRQSMFPDR
GO12444 PARA Peptide | IKEFPLDGSWGN
GO12445 SCNA Peptide | LELGLEGVQG
GO12446 Ighg1 Peptide | PE(pY)KNMIGQAP
GO12447 COL1A1 Peptide | VPGPMGPSGPR
GO12448 At1g10950 Peptide | LRNDYAKYAREDDD
GO12449 Gm16286 Peptide | QENLAGGDSGSDGKDC
GO12450 SERPINF1 Peptide | Ac-YEGEVTKSLQEMKLQSLFDS-CONH2
GO12451 SERPINF1 Peptide | Ac-PDFSKITGKPIKLTQVEHRA-CONH2
GO12452 SERPINF1 Peptide | Ac-GFEWNEDGAGTTPSPGLQPA-CONH2
GO12453 SERPINF1 Peptide | Ac-HLTFPLDYHLNQPFIFVLRD-CONH2
GO12454 Rpl14 Peptide | Ac-KKAAVAKAAIAA-CONH2
GO12455 Mapk8ip2 Peptide | EEEEEEEE
GO12456 RGD Peptide | c[RGDfK(Biotin)]
GO12457 RGD Peptide | c(RGDyK)
GO12458 GRA6 Peptide | CLHPERVNVFDY
GO12459 Gm11172 Peptide | RRRRRRRR
GO12460 PTX-1 Peptide | DYKDDDDK
GO12461 CLE1 Peptide | RLSPGGPDPRHH
GO12462 Q8C5U4 Peptide | ENQLWQNTLRCCEQYQESPQDAEN
GO12463 illr3 Peptide | CASLGHPDGETDFWT
GO12464 ighz Peptide | TKKQRYQSDIMC
GO12465 il1b Peptide | DSAVYSDSDEMDC
GO12466 si:ch211-261n11.7 Peptide | NGSVMSCLPHSKCEMMC
GO12467 tnfsf14 Peptide | CAMSKQDKVVAEPKKNR
GO12468 tnfsf14 Peptide | SLHPKIPRPSIENSFLC
GO12469 large T Peptide | EVNMKNFILQYL
GO12470 Poly-His-poly-Gly Peptide | HHHHHHHHHH
GO12471 RANKl Peptide | LMVYVTKTSIKIPSS
GO12472 DEFB129 Peptide | NYLQYGTPNVLNEDVQEMLKPA[13C,15N-K]
GO12473 F5H202 Peptide | (3,3,3-trifluoropropionyl)TFP-VPQTVPMRLRKLPDSFFKPPE-CONH2
GO12474 Tachyplesin-1 Peptide | KWCFRVCYRGICYRRCR-CONH2
GO12475 CNAG_03012 Peptide | APAAEPQPSVKSNNFGAPGGAYPW
GO12476 Poly-His-poly-Gly Peptide | HHHHHHHHHHHH
GO12477 AKAP1 Peptide | MLALLGWWWFFSRKKC
GO12478 L484_008270 Peptide | DFR(hyP)TAPGHS(hyP)GVGH
GO12479 D7 Peptide | DDDDDDD
GO12480 tat Peptide | FITC-GRKKRRQRRRPPQQ
GO12481 D8 Peptide | DDDDDDDD
GO12482 APP Peptide | Ac-FRHD(pS)GYEV-CONH2
GO12483 DIO2 Peptide | SRSKSTRGEWRRMLTSC
GO12484 clspn Peptide | LAAVSDLNPNAPR
GO12485 HMHA1 Peptide | VLHDDLLEA
GO12486 BnaA07g37340D Peptide | SPPPPVKHYSPPPVYHSPPPPKKHYVYK
GO12487 OCBIM_22027226mg Peptide | HHHHHHHHHHHHH
GO12488 P4 Peptide | RLLRLLRLL
GO12489 OCBIM_22027226mg Peptide | HHHHHHHHHHHHHHHHHHH
GO12490 OCBIM_22027226mg Peptide | HHHHHHHHHHHHHHHH
GO12491 OCBIM_22027226mg Peptide | HHHHHHHHHHHHHHHHHH
GO12492 D5Des Peptide | AYDVTNFVK
GO12493 P2RX5 Peptide | TPNQRQNVC
GO12494 Sk-FAD2 Peptide | NINNCGVGAAEK
GO12495 OCBIM_22027226mg Peptide | HHHHHHHHHHHHHHHHHHHH
GO12496 Rh5 Peptide | AYDKVKSKCNDIKNDLIATI
GO12497 MICPUCDRAFT_32578 Peptide | DASTAPVDLK
GO12498 Sk-FAD2 Peptide | GSSSNTEQEVPK
GO12499 Rh5 Peptide | KSSTYGKCIAVDAFIKKINE
GO12500 LMP2 Peptide | Biotin-GGWRIEDPPFNSLGG
GO12501 H15 Peptide | HHHHHHHHHHHHHHH
GO12502 K6 Peptide | FITC-Ahx-KKKKKK
GO12503 ODE2 Peptide | NCNNVGVKPK
GO12504 PEP2 Peptide | DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED
GO12505 D9 Peptide | DDDDDDDDD
GO12506 Ccl2 Peptide | Ac-QPDAVNAPLT-CONH2
GO12507 MCP1 Peptide | Ac-QPDAINAPVT-CONH2
GO12508 SNX24 Peptide | KLSHQPVLL
GO12509 Peptide:Abz-LPETGGG
GO12510 HHV3gp69 Peptide | WNMRGSDGTSTYATFLVTWK
GO12511 HHV3gp69 Peptide | VLMGFGIITGTLRITNPVRA
GO12512 PGM5 Peptide | QQFAVGSHV
GO12513 Peptide | c(RGDfK)
GO12514 amiB Peptide | Ac-NSQSDPYLSQAVLDLQ-CONH2
GO12515 E Peptide | AWDFGSVGGALNSLGKGIHQIF
GO12516 E Peptide | AWDFGSVGGALNSLGKGIHQIFGAAFKSL
GO12517 Envelope protein Peptide | AWDFGSIGGVFNSIGKAVHQVF
GO12518 TREM2 Peptide | Ac-CAHVEHSISRS-CONH2
GO12519 Igkv1-132 Peptide | SSQSLLYSNGK
GO12520 JCM19047_162 Peptide | WTAFDWYS
GO12521 Kng1 Peptide | HGHGHGHGKHTNKDKNSVKQTTQR
GO12522 Hrubri_2403 Peptide | LVYAMPYDA
GO12523 ompA Peptide | CTTEATDTKSAT
GO12524 bamA Peptide | SLSNMQPQVAMWRYLNSMGQYPDNTNDRNSFS
GO12525 A5707_19290 Peptide | LVYSMPYDA
GO12526 AHR Peptide | GIKSNPSKRHRDRLC-CONH2
GO12527 D4Des Peptide | VHH[13C,15N-G]FYPR
GO12528 OsI_27250 Peptide | PASGHPVTSEPSSPKSLHSP-CONH2
GO12529 OsI_27250 Peptide | RPMFGGRGFVPFSPGSPTEQSHGGR
GO12530 luc Peptide | LMYRFEEEL
GO12531 luc Peptide | Biotin-KEGRKSRWKRKVSS-CONH2
GO12532 MPSP Peptide | VDGKFKKLEQSEANKDLHA-CONH2
GO12533 PIWIL3 Peptide | CILPNDDKRRYDSIKR-CONH2
GO12534 APOL2 Peptide | CDKNRHDKDQQ
GO12535 APOC3 Peptide | LSGFWDLNPEAK
GO12536 KNG1 Peptide | EKQRKHNLGHGHKHERDQGHGHQR
GO12537 HRK Peptide | Ac-WSSAAQLTAARLKALGDELHQ-CONH2
GO12538 TP53 Peptide | CRHKKLMFKTEGPDSD
GO12539 CAMK2N1 Peptide | FITC-KRPPKLGQIGRSKRVVIEDDRI
GO12540 KNG1 Peptide | HKHGHGHGKHKNKGKKNGK
GO12541 KNG1 Peptide | HKHGHGHGKHKNKGKKNGKH
GO12542 KNG1 Peptide | GHGHGKHKNKGKKNGKHNGWK
GO12543 KNG1 Peptide | HKHGHGHGKHKNKGKKNGKHNG
GO12544 KNG1 Peptide | HGHGHGKHKNKGKKNGKHNGWK
GO12545 KNG1 Peptide | KHGHGHGKHKNKGKKNGKHNGWK
GO12546 KNG1 Peptide | HKHGHGHGKHKNKGKKNGKHNGW
GO12547 P2RX5 Peptide | TPNQRQNVC
GO12548 GAPDH Peptide | CHQVVSSDFNSDT-CONH2
GO12549 SMAD7 Peptide | FRTKRSALVRRLWRSC
GO12550 TGFBR3 Peptide | TSLDASIIWAMMQN
GO12551 SERPINF1 Peptide | QRTESIIHRALYYDLIS
GO12552 SMC1A Peptide | EGSSQGEDSVSGSQR
GO12553 A6R68_01704 Peptide | SSQSLLYSDGK
GO12554 amiA Peptide | Ac-YKATDKDHLLQQVLFDLVQ-CONH2
GO12555 tat Peptide | Ac-YGRKKRRQRRR
GO12556 tat Peptide | YGRKKRRQRRR
GO12557 RS1 Peptide | KKVALDQACFRISGAARNSSSFISHRK
GO12558 HTN3 Peptide | FITC-AKRHHGYKRKFH-CONH2
GO12559 SCT Peptide | HSDGTFTSELSRLRDSARLQRLLQGLV-CONH2
GO12560 OXT Peptide | KKCYIQNCPLG-CONH2 (Disulfide Bridge:C3-C8)
GO12561 GLAA Peptide | SIYTLNDGLSDSEAVAVGR
GO12562 OK074_0024 Peptide | LGLGSTLYTHL[13C,15N-L]K
GO12563 Bad Peptide | Ac-LWAAQRYGRELRRMSDEFEGSFKGL-CONH2
GO12564 Rpl6 Peptide | Ac-CAGSDAAASRPRAAKVAKKVHPKG-CONH2
GO12565 Sk-FAD2 Peptide | GSSSNTEQE[13C,15N-V]PK
GO12566 Ccl2 Peptide | Pyr-PDAVNAPLT-Peg3-C-CONH2
GO12567 sp Peptide | YDSDGKESKSDHDKRPKDKK-CONH2
GO12568 Rpl14-ps1 Peptide | Ac-CKKAAVAKAAIA-CONH2
GO12569 Trem2 Peptide | Ac-CAQVEHSTSRN-CONH2
GO12570 MCP1 Peptide | Pyr-PDAINAPVT-Peg3-C-CONH2
GO12571 MCP1 Peptide | QPDAINAPVT-Peg3-C-CONH2
GO12572 Outer membrane protein Peptide | PVGNPAEPSC
GO12573 pCF04 Peptide | EGLTPKENKC
GO12574 GCG Peptide | HGEGTFTSDVSSYLEGQAAKEFICWLVK-Aib-RG
GO12575 GCG Peptide | HGEGTFTSDVSSYLEGQAAKEFIAWLVK-Aib-RGCA-CONH2
GO12576 RAF1 Peptide | NYRWRCKNQN
GO12577 amiB Peptide | Ac-SEMASWLEQHEKQSELLGGAGDVLANSQSDPYLSQAVLDLQ-CONH2
GO12578 UGT1A1 Peptide | TYPVPFQR
GO12579 HYNIC Peptide | HYNIC-KdPdLdPdR
GO12580 V isotopes Peptide | VIWIFY[13C,15N-V]SK
GO12581 IFA Peptide | Ac-LKLIFLHRLKRLRKRLKR-CONH2
GO12582 BCL2L11 Peptide | Ac-MRPEIWIAQELRRIGDEFNA-CONH2
GO12583 KNG1 Peptide | HGHGKHKNKGKKNGKHNGWK
GO12584 gamma Asp Peptide | SSQSLLYSD(GK)-COOH
GO12585 Acss1 Peptide | TRSGK(Ac)VMRRL
GO12586 IFA Peptide | GYRKPPFNGSIFG-CONH2
GO12587 gamma Glu Peptide | gamma-Glu-Ile
GO12588 gamma Glu Peptide | gamma-Glu-Phe
GO12589 Biotin Peptide | Biotin-GPQP(HCY)LPY
GO12590 PTH Peptide | AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF
GO12591 apamin Peptide | CNCKAPETALCTNYCFRN (Disulfide Bridge:C1-C11,C3-C15)
GO12592 Peptide | FDFASKYWPWLSSPDS-CONH2
GO12593 BN46_1127 Peptide | Ac-FLHRLKRLRKRL-CONH2
GO12594 RAF1 Peptide | Ac-CALRKTAHVNILLFAC-CONH2 (Disulfide Bridge:C1-C16)
GO12595 Fmoc Peptide | Fmoc-DYIGSRF
GO12596 Fmoc Peptide | Fmoc-FRGDF
GO12597 Peptide | RIVKHFKLGGGAS-CONH2
GO12598 Peptide | SDGEQLSAR
GO12599 Peptide | ALPQRF-CONH2
GO12600 SCGN Peptide | YDADSSGFISAAALCNFLRDLFLHH
GO12601 PRLH2 Peptide:SPEIDPFWYVGRGVRPIGRF-CONH2
GO12602 PQRFa Peptide:NSQETVPAYVWMRAFPQRF-CONH2
GO12603 HTRA1 Peptide:RKLPFSKREVPV
GO12604 UBD Peptide:YNIQKESTLHLV-Peg3-K(Biotin)-CONH2
GO12605 HTRA1 Peptide:AKLPFSKREVPV
GO12606 HTRA1 Peptide:RKAPFSKREVPV
GO12607 HTRA1 Peptide:RKLPASKREVPV
GO12608 HTRA1 Peptide:RKLPFSKAEVPV
GO12609 agiopep-2 Peptide:Ac-Cys-peg2000-TFFYGGSRGKRNNFKTEEY
GO12610 Peptide:Fmoc-Cys(Stbu)-Arg(Pbf)-Arg(Pbf)-Lys(Boc)
GO12611 HTRA1 Peptide:RKLAFSKREVPV
GO12612 UBD Peptide:YNIQKESTLHLV-CONH2
GO12613 PQRFa Peptide:ADTSHFFQPQRF-CONH2
GO12614 CCL7 Peptide:QPVGINTSTT-Peg3-C-CONH2
GO12615 UL83 Peptide:NLVPMVATV
GO12616 DNAJC15 Peptide:TAKKISTPSFSSY-K(Biotin)-CONH2
GO12617 APOL1 Peptide:Biotin-Peg3-KSETAEELKKVAQELEEKLNIL-CONH2
GO12618 APOL1 Peptide:EDNIRRLRALADGVQKVH
GO12619 H2AFX Peptide:TRSSRAGLQFPVGRVHRLLRK
GO12620 APOL1 Peptide:Biotin-Peg3-QSVPHASASRPRVTEPISAE-CONH2
GO12621 APOL1 Peptide:NEADELRKALDNLARQMIMK
GO12622 APOL1 Peptide:Biotin-Peg3-QLTRGIGKDIRALRRARANL-CONH2
GO12623 APOL1 Peptide:Biotin-Peg3-SGEQVERVNEPSILEMSRGV-CONH2
GO12624 APOL1 Peptide:Biotin-Peg3-MGLAPFTEGGSLVLLEPGME-CONH2
GO12625 RAB10 Peptide:CRNIDEHANEDVEK
GO12626 APOL1 Peptide:Biotin-Peg3-PSILEMSRGVKLTDVAPVSF-CONH2
GO12627 APOL1 Peptide:Biotin-Peg3-RALRRARANLQSVPHASASR-CONH2
GO12628 DNAJC15 Peptide:LRYAEYLQPSAKRPDAD-K(Biotin)-CONH2
GO12629 DNAJC15 Peptide:IWKPLEQVIT-K(Biotin)-CONH2
GO12630 THY1 Peptide:Peg3-CRHENTSSSPIQYEFSLTRE
GO12631 APOL1 Peptide:Biotin-Peg3-PRVTEPISAESGEQVERVNE-CONH2
GO12632 Prelp Peptide:RKMPPKVPQAIHQLYLDSNKIETIPNGYFKDFPNLAFIRMNYNKL
GO12633 AGO2 Peptide:ACFAPQRQCT
GO12634 AGO2 Peptide:CDSFEDPTSTLVTSSGAFQC Cys1-Cys20
GO12635 Peptide:otbu-tyr-(EE)c
GO12636 azidohomo Peptide:RIVKHFKLGGRAVS-(L-azidohomoalanine)-CONH2
GO12637 Yap1 Peptide:DSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE
GO12638 Gm11172 Peptide:Stearic acid-RRRRRRRR
GO12639 AGT Peptide:DRVYIHPFHL (Acetate)
GO12640 APOL1 Peptide:Biotin-Peg3-QELEEKLNILNNNYKILQADQEL-CONH2
GO12641 tat Peptide:CGGRKKRRQRRRAP
GO12642 NS3 Peptide:CINGVCWTV
GO12643 CD3E Peptide:pE-DGNEEMGGIT-(Peg3)-K(Biotin)-CONH2
GO12644 Cxcl13 Peptide:CLQRLLRHVQSKSL
GO12645 E7 Peptide:YMLDLQPET
GO12646 PMEL Peptide:LRTKAWNRQLYPEWTEAQRLDCWRG
GO12647 US6 Peptide:KNFRGKNLPVLDQLTDRHG
GO12648 kiss2 Peptide:₂ FNYNPFGLRF-CONH2
GO12649 tat Peptide:Biotin-YGRKKRRQRRR
GO12650 EPO Peptide:GCAEHCSLNENITVPDTKV
GO12651 Peptide:MSNRNSSKGGKKGAESARQPDNKFNGGSHQGGKRGAESARERDEAFNGSGGRHNA
GO12652 Peptide:YADAIFTNSYRRVLGQLSAR-K【N-ε-(N-α-Palmitoyl-L-γ-glutamyl)】LLQDIMSRQQGESNQERGARARLGGC
GO12653 WNT10A Peptide:NKSSAGSDGCGS     
GO12654 DBCO Peptide:GGGS-K(FAM)-GGSK(DBCO)-CONH2
GO12655 A30 Peptide:DIQMTQSPSSLSASVGDR
GO12656 SCGN Peptide:YDADSAGFISAAELCNFLRDLFLHH
GO12657 GCG Peptide:HGEGTFTSDVSSYLEGQAAKEFIAWLVK-Aib-RGCA-CONH2
GO12658 TAC1 Peptide:RPKPQQFFGLM-NH2
GO12659 Peptide:DYK(Ac)DHDGDYK(Ac)DHDIDYK(Ac)DEDDK(AHA-Biotin)-CONH2
GO12660 env Peptide:LQNRRGLDLLFLKEGGL
GO12661 FGFR2 Peptide:HHHHHHHHSWTKDGVHLGP
GO12662 bombesin Peptide:pE-QRYGNQWAVGHLM-CONH2
GO12663 Peptide:H-Aib-QGTFTSDYSKYLEEEAVKLFICWLVKGR-CONH2
GO12664 Peptide:H-Aib-EGTFTSDYSKYLDERAAQEFVQWLVKGRGC-CONH2
GO12665 Hirudin Peptide:Ac-DFEEIPEEYLQ
GO12666 Calmodulin Peptide:HVMTNLGEKLTDEEVDEMIREGG-K(Biotin)-CONH2
GO12667 Msln Peptide:GQKMNAQAI
GO12668 Peptide:H-Aib-EGTFTSDYSKYLDERAAQEFICWLVKGR-CONH2
GO12669 KSYK Peptide:CVEPRLRDYYYDI
GO12670 VIM Peptide:Biotin-TTDS-ATRSSAV-Cit-L-Cit-SSVPGVRLLQDS-Amid
GO12671 MAP8 Peptide:{[(Small molecule compounds)2-K]2-K}2-K-C
GO12672 UNG Peptide:LSAEQLDRIQRNKAAALLRLAARNV
GO12673 Peptidase Peptide:Ac-WEWEIEI-CONH2
GO12674 Adgrg2 Peptide:TSFGILLDLSRTSLP-CONH2
GO12675 TEAD4 Peptide:MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPI
GO12676 SRSF1 Peptide:RSPSYGRSRSRSRSRSRSRSRSNSRSRSY
GO12677 F5H202 Peptide:Biotin-AGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE
GO12678 bmp7 Peptide:FITC-GQGFSYPYKAVFSTQ
GO12679 PTX-1 Peptide:Biotin-Acp-DYKDDDDK
GO12680 c-src Peptide:LEDYFTSTEPQYQPGENL
GO12681 CLE16 Peptide:RLVHTGPNPLHN
GO12682 Peptide:Phenylalanine tert-butyl ester-(EE)c
GO12683 CLE8 Peptide:RRVPTGPNPLHH
GO12684 CLE13 Peptide:RLVPSGPNPLHH
GO12685 CLE10 Peptide:RLVPSGPNPLHN
GO12686 CLE11 Peptide:RVVPSGPNPLHH
GO12687 CLE12 Peptide:RRVPSGPNPLHH
GO12688 CLE14 Peptide:RLVPKGPNPLHN
GO12689 CLE18 Peptide:RQIPTGPDPLHN
GO12690 CLE20 Peptide:RKVKTGSNPLHN
GO12691 CLE26 Peptide:RKVPRGPDPIHN
GO12692 CLE27 Peptide:RIVPSCPDPLHN
GO12693 CLE42 Peptide:HGVPSGPNPISN
GO12694 CLE43 Peptide:RRIPSSPDRLHN
GO12695 OsCLE801 Peptide:RRVRRGSDPIHN
GO12696 CLE46 Peptide:HKHPSGPNPTGN
GO12697 KIF3B Peptide: FITC-Acp-FKKLKKLFSKLWNWK-CONH2
GO12698 HTN3 Peptide:DSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
GO12699 orf142 Peptide:GRSRSRSRSR
GO12700 KSYK Peptide:IISQRPQLEKLIAC
GO12701 KSYK Peptide:CVEPRLRDYYYDI
GO12702 FGFR2 Peptide:HHHHHHHHSWTKDGVHLGP
GO12703 CLE16 Peptide:RLVHTGPNPLHN
GO12704 CLE21 Peptide:RSIPTGPNPLHN
GO12705 CLE22 Peptide:RRVFTGPNPLHN
GO12706 CLE25 Peptide:RKVPNGPDPIHN
GO12707 Adgrg2 Peptide:Peg4-TSFGILLDLSRTSLP-CONH2
GO12708 Lactonohydrolase Peptide:GIEFSPDLK
GO12709 RGF6 Peptide:D-Y(SO3)-PQPHRKP-Hyp-IHNE
GO12710 Peptide:ARYRRSRTRSRSPRSRRRRRRSGRRRSPRRRRRYGSARRSRRSVGGRRRRYGSRRRRRRRY
GO12711 Peptide:KKALLHAALAHLLALAHHLLALLKKA-CONH2
GO12712 HSPB1 Peptide:LLRGPSWDPFRC
GO12713 GSTM1 Peptide:IEAIPQIDK
GO12714 sodC Peptide:GLEFSPDLK
GO12715 AgaP_AGAP000671 Peptide:KIKTIELRGKKIKC
GO12716 Peptide:NYCKPTDRQYHF all D-type amino acids
GO12717 NCOR1 Peptide:Ac-GHSFADPASNLGLEDIIRKALMG-CONH2
GO12718 Yap1 Peptide:DSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE
GO12719 Histone H2A Peptide:AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY
GO12720 MED1 Peptide:Ac-VSSMAGNTKNHPMLMNLLKDNPAQ-CONH2
GO12721 TCRg Peptide:SSEEEDEFFLQLLKQSSRRLEHTFVFL (HCL salt)
GO12722 HTT Peptide:Ac-ATLEKLMKAFESLKSFC
GO12723 SDC4 Peptide:NHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSM (HCL salt)
GO12724 Peptide:Biotin-GGGGGDYKDDDDK
GO12725 Peptide:WAWLGEGSRVLGTVRAPTSV(Peg)K(FITC)
GO12726 TCRg Peptide:SSEEEDERNFSLMLLRGIGKKRRATRF (HCL salt)
GO12727 TCRg Peptide:SSEEEDEIGKKRRATRFWDPRRGTP (HCL salt)
GO12728 MMP14 Peptide:GGESGFPTKMPPQPRTTSRPSVPDKPKN
GO12729 FABP Peptide:MADAFVGTWKLVDSKNFDDY (desalt)
GO12730 EGFR Peptide:Biotin-KITDFGRAKLLGAE
GO12731 EGFR Peptide:Biotin-KITDFGLAKLLGAE
GO12732 Cxcl13 Peptide:QVTPPGNGCPKTEV
GO12733 C0PFR1 Peptide:ASMRERRTTCHPDVV
GO12734 F775_31911 Peptide:SAQPEKAREVFNEMC
GO12735 Peptide:Dabcyl-EVHHQKL-E(EDANS)-CONH2
GO12736 Peptide:Dabcyl-EVHHQKLV-E(EDANS)-CONH2
GO12737 AAES_18462 Peptide:KRKRKRKRKRKRKRKRKR
GO12738 Trem2 Peptide:Biotin-Peg3-LEDPLDDQDAGDLWVPEESS-CONH2
GO12739 MOG Peptide:MEVGWYRSPFSRVVHLYRNGK
GO12740 cd8a Peptide:CETWIFTSLVGG
GO12741 cd8a Peptide:TTLKPVVKTTMIKQC
GO12742 zbtb46 Peptide:SSNYGKEDQEPKSHESC
GO12743 zbtb46 Peptide:CEENGKWRAGSGMSQ
GO12744 HDAC3 Peptide:CVSTRIENQNSRQYLEQI
GO12745 tlr2 Peptide:NLRSYENGSLKAARPC
GO12746 tlr2 Peptide:CVTMKTNTSTEP
GO12747 caspa Peptide:CYHRTNNPSDSFPV
GO12748 caspb Peptide:CFSKRREHEDADS
GO12749 il6 Peptide:DVKTLRDEQFERDFRC
GO12750 il6 Peptide:CMSRRKRGKDPKRTGD
GO12751 EGFR Peptide:Biotin-KIPVAIKTSPKANKE
GO12752 TREM2 Peptide:Biotin-Peg3-LADPLDHRDAGDLWFPGESE-CONH2
GO12753 gpe1 Peptide:VWNQPVRGFKVYE
GO12754 HCRT Peptide:MSKTESRKL(pS)DDYEVVD
GO12755 GAS1 Peptide:CLDDYYDEDYDDEQRT
GO12756 MMP14 Peptide:SGFPTKMPPQPRTTSRPSVPD
GO12757 il6 Peptide:CDVKTLRDEQFERDFR
GO12758 BCL2L11 Peptide:CRPPQLRPGAPTSLQTEP
GO12759 DLL3 Peptide:Biotin-FPVHPDGASALPAAPPGLRPGDPQR-CONH2
GO12760 UBD Peptide:Biotin-Ahx-NIQKE(pS)TLHLV
GO12761 CCAMK Peptide:MYDADR(pS)GCISKE
GO12762 ERVWE1 Peptide:TEKVKEIRDRIQRRAEELRNTGPW
GO12763 ERVWE1 Peptide:LNFRPYVSIPVPEQWNN
GO12764 E2 Peptide:NNCKVDQCHAAV
GO12765 EGFR Peptide:IMQLMPFGCLL
GO12766 EGFR Peptide:MQLMPFGCLL
GO12767 BN450_02075 Peptide:IMQLMPFGV
GO12768 EGFR Peptide:ITQLMPFGC
GO12769 EGFR Peptide:TQLMPFGCLL
GO12770 EGFR Peptide:LITQLMPFGCL
GO12771 Bsn Peptide:LDFGQGSGSPVCLAQVK
GO12772 BnaCnng58970D Peptide:WDHHAPQLR
GO12773 IL33 Peptide:Biotin-ECKTDPGVFIGVKDNHLALI-CONH2
GO12774 ERVWE2 Peptide:SIPVPEQWNNFSTEINTT
GO12775 HIF-1A Peptide:Biotin-KSRDAARSRRSKESEVFYELAH
GO12776 HIF1A Peptide:Biotin-KSRDAARSRRSK(me)ESEVFYELAH
GO12777 IL33 Peptide:Biotin-LSYYESQHPSNESGDGVDGK-CONH2
GO12778 Peptide:Ac-GSGDDAHVSAAENAALLTGGSGSGSSMPIFDALQYFSPP-CONH2
GO12779 CSK21 Peptide:Ac-KYPGGSTPVSSANMM
GO12780 E2 Peptide:RTLMSQQSGNVKITV
GO12781 E2 Peptide:QQSGNVKITVNSQTV
GO12782 E2 Peptide:VKITVNSQTVRYKCN
GO12783 E2 Peptide:RYKCNCGDSSEGLTT
GO12784 E2 Peptide:TDKVINNCKVDQCHA
GO12785 SNCA Peptide:MPVDPDNEAYEMPSE-CONH2
GO12786 BN450_02075 Peptide:IMQLMPFGC
GO12787 11S-2 Peptide:ADAFNVDTETA
GO12788 RAS Peptide:CLPSRTVDTKQAQDLA
GO12789 tat Peptide:FITC-GRKKRRQRRRPPQQ
GO12790 tat Peptide:Ac-MEPVDPRLEPWKHPGSQPKTACNK(Biotin)-COOH,
GO12791 GPC Peptide:DNMITEMLQKEYMERQGK
GO12792 GPC Peptide:NYSKYWYLNHTTTGRTSLPK
GO12793 C6T6T1 Peptide:KKKKKKKKKKKKKKKKKK
GO12794 TP53 Peptide:ALNKMFCQLAKTCPK(Biotin)-COOH
GO12795 TTN Peptide:FITC-RIFVPIKGRPAP
GO12796 E2 Peptide:NSQTVRYKCNCGDSS
GO12797 IL33 Peptide:Biotin-KVDSSENLCTENILFKLSET-CONH2
GO12798 DPYSL2 Peptide:GLYDGPVCEVSVTPK
GO12799 tat Peptide:YGRKKRRQRRR
GO12800 TJP1 Peptide:CYYDDKQPYPSRPPFD
GO12801 Trak1 Peptide:YTPSLNSAPAPACSSTSHLK
GO12802 Cox4p Peptide:MLSLRQSIRFFKKHKHKHKHKHKHKHKHKH 
GO12803 SNCA Peptide:GAPQEGILEDMPVDPDNEAY-CONH2
GO12804 IGHE Peptide:CAFATPEWPGSRDKRTL
GO12805 GPC Peptide:IQLINKAVNALINDQLIMK
GO12806 IGHE Peptide:CSGKPVNHSTRKEEK
GO12807 ADD2 Peptide:Myristic acid-GSSKSPSKKKKKKPGDC(Npys)-CONH2
GO12808 EPCAM Peptide:CAEIKEMGEMHRELNA
GO12809 ACMD2_05359 Peptide:CAAAHHHHHHK
GO12810 F2r Peptide:NPSENTFELVPLGDE
GO12811 NP Peptide:LTYSQLMTL-CONH2
GO12812 IGHG1 Peptide:KVEPKSCDKTHT
GO12813 IGHE Peptide:DFTPPTVKILQSC
GO12814 IGHG1 Peptide:VSHEDPEVKFNWYVDGVEC
GO12815 SNCA Peptide:METVQLRNPPRR 
GO12816 SNCA Peptide:Biotin-PEG6-EDMPVDPDNE-CONH2
GO12817 Peptide:Biotin-PEG6-GAPQEGILEDMPVDPDNEAY-CONH2
GO12818 ANT-C Peptide:RQIKIWFQNRRMKWKK
GO12819 SNCA Peptide:Biotin-PEG6-EGILEDMPVD-CONH2
GO12820 SNCA Peptide:Biotin-PEG6-MPVDPDNEAYEMPSE-CONH2
GO12821 BIML Peptide:CDREGRQLQPAERPPQL
GO12822 MAV100_00235 Peptide:ADSALQQQLDEVR
GO12823 SERPINF1 Peptide:DPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTN
GO12824 USP29 Peptide:YDFQKQAWFTYND 
GO12825 GCG Peptide:HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
GO12826 Protamine Peptide:VSRRRRRRGGRRRR
GO12827 SNCA Peptide:Biotin-PEG6-VDPDNEAYEM-CONH2
GO12828 NP Peptide:YQPSNGQYI
GO12829 Apela Peptide:RKLYRHNCFRR
GO12830 TDGF1 Peptide:Biotin-FARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPP 
GO12831 hslO Peptide:RLGVAELLDR
GO12832 UO65_4270 Peptide:RAYTPDEVR
GO12833 ERDMAN_1252 Peptide:SGPGAASSENRR
GO12834 lipV Peptide:VLTIHGVTEHGR
GO12835 Mb0626A Peptide:CGGDQLVEGAVVWNAPLR
GO12836 MGAST_02880 Peptide:FCQHHANEHEAK
GO12837 F2r Peptide:RSFFLRNPSENTFELVPLGD
GO12838 NRDE2 Peptide:CKKKHHHHKKKC
GO12839 Apela Peptide:CIPLHSRVPFP
GO12840 L2 Peptide:CSPQYTIIADAGDFYLHPSYYMLRKRRKR
GO12841 NP Peptide:KSFLWTQSL-CONH2
GO12842 IGHG1 Peptide:GFYPSDIAVEWESNGQPENNYK
GO12843 Membrane Peptide:PNPWQYIR
GO12844 ERS007734_02394 Peptide:PNLIFGPCR
GO12845 Mb0587A Peptide:RGQAGIVDDGAVLIHVPGECPHPGEHVPR
GO12846 ERS007728_01285 Peptide:AIEIDPGSSSFDSDALDQSPAASAAR
GO12847 ERDMAN_1252 Peptide:LDESDVDGYQSR
GO12848 RN08_0260 Peptide:TELGTTTIKDTVNAALR
GO12849 MGAST_02880 Peptide:AKLPSGAELLFCQHHANEHEAK
GO12850 Mb0587A Peptide:QTIEPGWLYITAHR
GO12851 J113_20230 Peptide:IATGFDGGDPLRAAAPR
GO12852 ERS007728_01285 Peptide:VNHAASAISPSLNENSSSGSPK
GO12853 Membrane Peptide:VHNLDPELVDEHAR
GO12854 RN08_0260 Peptide:HLVDIDEQALNMAR
GO12855 ERS024213_05906 Peptide:LLAAHAGQLAGATAGR
GO12856 ERS007663_00808 Peptide:IGLVQISVPVAK
GO12857 ERS024213_05906 Peptide:TQAGQAGEAAQEVR
GO12858 CTAG1A Peptide:ATPMEAELAR
GO12859 LMP Peptide:SSCSSCPLSK
GO12860 RGD Peptide:c(RGDf(N-me)V)
GO12861 DUF1059 Peptide:DAILFMAY
GO12862 MycrhN_3567 Peptide:WVGLAGVAGVVAGGALVAR
GO12863 RGD Peptide:E-2Ahx-[c(RGDfK)]2-PEG-MPA
GO12864 RGD Peptide:c(RGDfC)
GO12865 Peptide:VSLSYR-Peg3-K(biotin)-CONH2
GO12866 Peptide:VSLSYR-Peg3-C-CONH2
GO12867 Tat Peptide:Ac-RKKRRQRRRAPQDSKTHQVSLSKQP-K(Biotin)-COOH
GO12868 GP1 Peptide:GLNGPDIYKGVYQFKSVEFD
GO12869 Mb0587A Peptide:GQAGIVDDGAVLIHVPGECPHPGEHVPRS
GO12870 MT0031 Peptide:ELFGPNPIEPPTDIAPDPDSTK
GO12871 Mb0587A Peptide:RGQAGIVDDGAVLIHVPGECPHPGEHVPRS
GO12872 pheA Peptide:GPEGTFTEAALVRMVAAGLVPETGPDALQR
GO12873 HA Peptide:WTILKPNDAINFESN
GO12874 MT1192 Peptide:THLTCPCGEAITGK
GO12875 ERDMAN_0257 Peptide:VAAALDTLAAAPPEDR
GO12876 ERDMAN_2207 Peptide:MGITSVSVHSGAIAATPGSVAAAER
GO12877 A2YE19 Peptide:SGKVYRIHLTSRGGGATATA
GO12878 RBP3 Peptide:PTARSVGAADGSSWEGVGVVPDV
GO12879 Mb1603c Peptide:MAELRSGEGRTVHGTIVPYNEATTV
GO12880 Mb1603c Peptide:EATTVRDFDGEFQEMFAPGAFRRSI 
GO12881 CALCA Peptide:LSTCMLGTYTQDFNKFHTFPQ
GO12882 SAG Peptide:FLGELTSSEVATEV
GO12883 Q67U32 Peptide:CPAKGSRRKSNDVT
GO12884 MFN2 Peptide:KDDLVLMDSPGIDVTC
GO12885 Mb1603c Peptide:GVVDSFSVGFRPIRDRREGDVLVRV 
GO12886 Mb1603c Peptide:GAFEIADTPDGDEALANVKAGVVDS
GO12887 Mb1603c Peptide:RTRYPVGRAVELREEPHGLFGAFEI
GO12888 Peptide:propargylglycine-RRRRRRRR
GO12889 Mb0587A Peptide:GQAGIVDDGAVLIHVPGECPHPGEHVPR
GO12890 CALCA Peptide:TYTQDFNKF
GO12891 CALCA Peptide:CMLGTYTQDFNKFHTFPQTAI
GO12892 Mb1607c Peptide:AHTRCWFIDADWTPLLAAELRYHGH
GO12893 Apela Peptide:KPVNFPRRRKLYRHNCFRRRCIPLHSRVPFP
GO12894 ERDMAN_2172 Peptide:VRVTLDNINGRWLISQFEPI
GO12895 S Peptide:PLGFFPDHQLDPAFGANSNNPDWDFNP
GO12896 CALCB Peptide:EDEARLLLAALVQDYVQMKA
GO12897 Peptide:Myr-beta Ala-RRRRRRRC-CONH2
GO12898 CALCA Peptide:QKFSPFLAL
GO12899 tat Peptide:CYGRKKRRQRRRC
GO12900 US6 Peptide:Biotin-KYALADASLKMADPNRFRGKDLPVLDQLLE

Bancos de dados de Peptídeos

Prncipais bancos de dados mundiais de peptídeos bioativos.

Name Link Description
AHTPDB http://crdd.osdd.net/raghava/ahtpdb/ Database of antihypertensive peptides
AllergenOnline Celiac Disease http://www.allergenonline.org/celiachome.shtml Database of celiac-toxic peptides and proteins associated with the AllergenOnline database
AMPer http://marray.cmdr.ubc.ca/cgi-bin/amp.pl Database of antimicrobial peptides and program searching for fragments with sequences similar to antimicrobial peptides in query protein sequence
ANTIMIC http://research.i2r.a-star.edu.sg/Templar/DB/ANTIMIC Database of antimicrobial peptides. Enables to search the similarities using BLAST
Antimicrobial Combination Networks http://sing.ei.uvigo.es/antimicrobialCombination/ Database annotating information about combinations of antimicrobial drugs and peptides
APD http://aps.unmc.edu/AP/main.html Database of antimicrobial and anticancer peptides
ArachnoServer http://www.arachnoserver.org/mainMenu.html Database of toxic peptides and proteins from spider venoms
ATDB http://protchem.hunnu.edu.cn/toxin Database of toxic proteins and peptides of animal origin
AVPdb http://crdd.osdd.net/servers/avpdb/ Database of antiviral peptides
BaAMPs http://www.baamps.it/ Database of antimicrobial peptides tested against microbial biofilms
BACTIBASE http://bactibase.pfba-lab-tun.org Database of antibacterial peptides (bacteriocins)
BactPepDB http://bactpepdb.rpbs.univ-paris-diderot.fr/cgi-bin/home.pl Database of predicted bacterial peptides
BAGEL2 http://bagel2.molgenrug.nl/ Database of antibacterial peptides (bacteriocins)
BAGEL3 http://bagel.molgenrug.nl/ Database of antibacterial peptides (bacteriocins)
BioLiP http://zhanglab.ccmb.med.umich.edu/BioLiP/ Database of protein-ligand interactions. Contains e.g. peptides known as protein ligands
BioPD http://biopd.bjmu.edu.cn Database of biologically active peptides
BioTherapi http://crdd.osdd.net/raghava/biotherapi/db.html Metabase of peptides revealing bioactivity and useful as drugs
Brainpeps http://brainpeps.ugent.be/ Database of peptides passing through the blood-brain barrier
CAMP http://www.bicnirrh.res.in/antimicrobial/ Database of antimicrobial peptides and proteins
CancerPPD http://crdd.osdd.net/raghava/cancerppd/index.php Database of anticancer peptides
ClusterMine360 http://www.clustermine360.ca/ Database of non-ribosomal peptides including information about their pharmacological activity and genes encoding enzymes involved in biosynthesis
ConoServer http://research1t.imb.uq.edu.au/conoserver/ Database of biologically active peptides of snails from the genus Conus
C-PAmP http://bioserver-3.bioacademy.gr/Bioserver/C-PAmP/ Database of in silico predicted antimicrobioal peptides of plant origin
CPPsite http://crdd.osdd.net/raghava/cppsite/ Database of cell-penetrating peptides
Cybase http://www.cybase.org.au/?page=welcome Database of cyclic proteins and peptides with various bioactivities
DADP http://split4.pmfst.hr/dadp/ Database of defense peptides. Includes mainly antimicrobial activities involved in biosynthesis
DAMPD http://apps.sanbi.ac.za/dampd/ Database of antimicrobial and hemolytic peptides
DBAASP http://www.biomedicine.org.ge/dbaasp/ Database of antimicrobial peptides
Defensins knowledgebase http://defensins.bii.astar.edu.sg Database of antimicrobial peptides from the defensins family
EROP-Moscow http://erop.inbi.ras.ru Database of biologically active peptides
Hemolytik http://crdd.osdd.net/raghava/hemolytik/ Database of hemolytic peptides
HIPdb http://crdd.osdd.net/servers/hipdb/ Database of HIV inhibiting peptides
Hmrbase http://crdd.osdd.net/raghava/hmrbase/ Database of hormones, e.g. peptides
IMGT Immunoinformatics http://imgt.cines.fr/textes/Immunoinformatics.html#datPEP Website providing access to databases of antimicrobial peptides
Kalium http://kaliumdb.org/ Database of toxic peptides from scorpion venom acting against potassium channels
KEGG Peptide http://www.genome.jp/dbget-bin/www_bfind_sub?max_hit=1000&serv=gn&dbkey=compound&keywords=peptide&page=1 List of peptides annotated in KEGG datatabase
LabWorm Antimicrobial peptide https://labworm.com/category/protein-peptide/antimicrobial-peptide Metabase of antimicrobial peptides
LAMP http://biotechlab.fudan.edu.cn/database/lamp/ Database of antimicrobial peptides
MBPDB http://mbpdb.nws.oregonstate.edu/ Database of bioactive peptides from milk
MilkAMP http://milkampdb.org/home.php Database of antimicrobial peptides from milk
NeuroPedia http://proteomics.ucsd.edu/Software/NeuroPedia/index.html Database of neuropeptides including library of mass spectra
NeuroPep http://isyslab.info/NeuroPep/ Database of neuropeptides
NORINE http://bioinfo.lifl.fr/norine/ Database of nonribosomally synthesized bioactive peptides
OMICTools Peptide http://omictools.com/peptide-prediction-category Metabase of peptides at the OMICTools website
ParaPep http://crdd.osdd.net/raghava/parapep/ Database of antiparasitic peptides
PepBank http://pepbank.mgh.harvard.edu A database of biologically active peptides providing program searching for fragments with sequences similar to peptides in the database
PepBind http://pepbind.bicpu.edu.in/ Database containing information about protein-peptide interactions
Peplife http://crdd.osdd.net/raghava/peplife/ Database containing information about halflife of experimentally validated therapeutic peptides
PeptideDB http://www.peptides.be/ Major database of biologically active peptides, peptide precursors and motifs in Metazoa
PepX http://pepx.switchlab.org/ Database of structures of protein-peptide complexes
PhytAMP http://phytamp.pfba-lab.org Database of antimicrobial peptides and proteins of plant origin
ProPepper https://propepper.net/ Database of peptides of cereal origin
Quorumpeps http://quorumpeps.ugent.be/ Database of bioactive peptides. Structures are written in SMILES notation apart from single-letter code. Enables structure comparison between peptides and peptidomimetics
RAPD http://faculty.ist.unomaha.edu/chen/rapd/index.php Database of recombinant antimicrobial peptides
SATPdb http://crdd.osdd.net/raghava/satpdb/links.php Metabase of bioactive peptides
SwePep http://www.swepep.org Database of biologically active peptides including sophisticated computing tools for peptide mass spectra interpretation
THPdb http://crdd.osdd.net/raghava/thpdb/index.html Database of therapeutic peptides
TumorHoPe http://crdd.osdd.net/raghava/tumorhope/ Database of tumor-recognizing peptides
WALTZ-DB http://waltzdb.switchlab.org/ Database of amyloid hexapeptides
YADAMP http://www.yadamp.unisa.it/ Database of antimicrobial peptides